DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c(3)G and KAR5

DIOPT Version :9

Sequence 1:NP_650490.1 Gene:c(3)G / 47765 FlyBaseID:FBgn0000246 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_013781.1 Gene:KAR5 / 855087 SGDID:S000004669 Length:504 Species:Saccharomyces cerevisiae


Alignment Length:451 Identity:92/451 - (20%)
Similarity:190/451 - (42%) Gaps:78/451 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LNNLKKKDLVVSKKMRAIAMDSLKKK---SENISLKEKLTNMELELTQLKTDLIEQQEKNAENIQ 197
            :|||.:..|:.:.  .::|.:.|:.|   .::..:|:.|   :|.|.|...:       ..|:|.
Yeast    25 INNLLQGRLIYTD--NSVATNVLESKFPFLKSTCVKDAL---KLFLPQCIAN-------GLESID 77

  Fly   198 KYTEINK--KYTHCEQHYDKELEIIKVCVEKKNSELRDAQSRMALQAQELNNMQQTNRELAGACE 260
            ..|.:..  |.:.||.......||.:.|:......:.|....:...:|.........:.|:..|.
Yeast    78 AETRVETAIKLSICEFQASGLGEIPENCMVDDLGSMMDCMFELESSSQWWTTYSGNYQRLSSICY 142

  Fly   261 NYKKDLEEAEVAKSMI-LHELTDLKELHEDLQLQFEDVSAQKEKFEANILQLSSDLNAKMLDCAQ 324
            ......|:.::.|..: :.||.|  ...:|:..:...:..|.|:...|.|   .|| |:|.   :
Yeast   143 ENLLPFEKEQILKLFLNITELYD--SFGDDVDTKLNHLMFQMEQDSQNFL---DDL-ARMF---R 198

  Fly   325 LEDRIEQLPIEANKALSKLQRDL-----EASELQFVDQQRLTDQATRELELVRNEINTFKTLIEE 384
            ..|...:...|:|:.:  |:.||     :.:::.:...::|..|...:...:.||::|...::.:
Yeast   199 NYDNELRNATESNRII--LENDLSFFRNKVNDVLYETSEQLEVQIIEKNSQLMNEVDTVHHIMSD 261

  Fly   385 KERRHVSLSDELTQMTERLSELADINESYINELTETKLKHSQEIKDQADAYEIVVQELKE--SLN 447
                   |:|||.:        .|| :|.||:|.:..|.:.|::.:.::       ::||  |.|
Yeast   262 -------LADELAK--------NDI-KSKINDLKDDSLNNLQDLVEMSN-------DVKEYYSRN 303

  Fly   448 KASVDFTQLKSNSEKLHKE---TLLQVSELQEKLIEMVSHRSN--QEELIKRLGNEIQEKTHNFE 507
            ...|: |:|::.|..|.|:   ....:||.|.:.||::...::  .:.|:..:.:||..:..||:
Yeast   304 NKLVN-TELENFSMGLKKQLGGMSKDLSESQMEAIELLQGFNSILHDSLLPSMTDEIVPEMTNFK 367

  Fly   508 EELKRQQEQLANQMQMKATEVESENKRNAV---EIQKLKSELEERNKAFKAQQDKLEYLIS 565
            ..|.::...:.:.:          |...|:   ||....:::.|:....|.:.|.:|..:|
Yeast   368 NTLLQEWTAITSTL----------NGDFALWNEEIFSTFNDISEKLNGTKKKLDDIEIRVS 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c(3)GNP_650490.1 iSH2_PI3K_IA_R 363..>516 CDD:304922 37/159 (23%)
KAR5NP_013781.1 Tht1 2..504 CDD:282073 92/451 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.