DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c(3)G and PPFIA3

DIOPT Version :9

Sequence 1:NP_650490.1 Gene:c(3)G / 47765 FlyBaseID:FBgn0000246 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_003651.1 Gene:PPFIA3 / 8541 HGNCID:9247 Length:1194 Species:Homo sapiens


Alignment Length:516 Identity:122/516 - (23%)
Similarity:210/516 - (40%) Gaps:136/516 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LKKKDLVVSKKMRAIAMDSLKKKSENISLKEKLTNMELEL-----------TQLKTDLIEQQEKN 192
            |.::...::|::.......|:::.|...||.:..|..|.|           ..|:..::::|.::
Human    78 LPQEFAALTKELNLCREQLLEREEEIAELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQS 142

  Fly   193 AENIQKYTEINKKYTHCEQHYDKELEIIKVCVEKKNSELRDAQSRMALQAQE--------LNNMQ 249
            ...:....|:.|......:|:       |...||....||.|..|:|:..:|        ||..:
Human   143 PGGVSSEVEVLKALKSLFEHH-------KALDEKVRERLRMALERVAVLEEELELSNQETLNLRE 200

  Fly   250 QTNRELAGACENYKKDLEEAEVAKSMILHELTDLK--ELHEDLQLQFEDVSAQKEKFEANILQLS 312
            |.:|..:| .|...||.:...:|..:.....::.:  ||.|.|:.|..:|...:|:......|:|
Human   201 QLSRRRSG-LEEPGKDGDGQTLANGLGPGGDSNRRTAELEEALERQRAEVCQLRERLAVLCRQMS 264

  Fly   313 SDLNAKMLDCAQLEDRIEQLPIE---ANKALSKLQRDLEASELQFVD-QQRLTDQATRELELVRN 373
                       |||:.:.....|   |.:|.|||||||:.:..|..| ::|:|            
Human   265 -----------QLEEELGTAHRELGKAEEANSKLQRDLKEALAQREDMEERIT------------ 306

  Fly   374 EINTFKTLIEEKERRHVSLSDELTQMTERLSELADINESYINELT--ETKLKHSQEIKDQ-ADAY 435
                  ||    |:|::|...|.|       .|.|.|:...|||.  |:..:.|:|...| |:..
Human   307 ------TL----EKRYLSAQREAT-------SLHDANDKLENELASKESLYRQSEEKSRQLAEWL 354

  Fly   436 EIVVQELKESLNKASVDFTQLKSNSEKLHKETLLQVSELQEKLIEMVSHRSNQEELIKRLG--NE 498
            :...|:|:::|.||                |||.::                :.:|.:|:.  |:
Human   355 DDAKQKLQQTLQKA----------------ETLPEI----------------EAQLAQRVAALNK 387

  Fly   499 IQEKTHNFEEELKRQQEQL--ANQMQMKATEVE----SENKRNAVEIQKLKSELEERNKA-FKAQ 556
            .:|:..||||.|::.:.||  .||...:|.:.|    ..|||.:..:.||.||..||.:. .|.:
Human   388 AEERHGNFEERLRQLEAQLEEKNQELQRARQREKMNDDHNKRLSETVDKLLSESNERLQLHLKER 452

  Fly   557 QDKLEYLISDHDTLKSAIINLQAEKKEIESELSTAKVKFSEELQSQKDNLMKKVSELELEI 617
            ...||                  ||..:..|::..| |..:||...|:.|:.::..:::||
Human   453 MGALE------------------EKNSLSEEIANMK-KLQDELLLNKEQLLAEMERMQMEI 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c(3)GNP_650490.1 iSH2_PI3K_IA_R 363..>516 CDD:304922 35/157 (22%)
PPFIA3NP_003651.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..233 6/31 (19%)
BAR 237..>419 CDD:299863 66/253 (26%)
Taxilin 239..499 CDD:286771 88/347 (25%)
CDC37_N <398..498 CDD:296150 30/116 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 624..819
SAM_liprin-alpha1,2,3,4_repeat1 835..905 CDD:188961
SAM 838..901 CDD:197735
SAM_liprin-alpha1,2,3,4_repeat2 952..1017 CDD:188964
SAM 960..1015 CDD:197735
SAM_liprin-alpha1,2,3,4_repeat3 1037..1108 CDD:188967
SAM 1040..1107 CDD:197735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1157..1194
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.