DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c(3)G and CCDC73

DIOPT Version :9

Sequence 1:NP_650490.1 Gene:c(3)G / 47765 FlyBaseID:FBgn0000246 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001008392.2 Gene:CCDC73 / 493860 HGNCID:23261 Length:1079 Species:Homo sapiens


Alignment Length:740 Identity:157/740 - (21%)
Similarity:290/740 - (39%) Gaps:223/740 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 TQEDQTFAATIDSSTKSLKKSPKNEGELWADIQKLSPHTGIIIHSFIKQYNESLNNLKKKDLVVS 147
            |:...||  |:.||:::|           ..||.|...|.::         |:|..|:       
Human     7 TESSSTF--TLQSSSETL-----------FSIQLLDFKTSLL---------EALEELR------- 42

  Fly   148 KKMRAIAMDSLKKKSENISLKEKLTNMELELTQLKTDLIEQQEKNAENIQKYTEINKKYTHCEQH 212
                      :::::| |..:|::..:.:|..:||.             ||.|..|:|.|..|||
Human    43 ----------MRREAE-IHYEEQIGKIIVETQELKW-------------QKETLQNQKETLAEQH 83

  Fly   213 ------YDKELEIIKVCV--EKKNSELRDAQSRMALQAQELNNMQQTNRELAGACENYKKDLEEA 269
                  :.|:|: :|:|.  |:|..    .|....::.:|:..:::|.:.|..:..:.:|.:.|.
Human    84 KEAMAVFKKQLQ-MKMCALEEEKGK----YQLATEIKEKEIEGLKETLKALQVSKYSLQKKVSEM 143

  Fly   270 E-------VAKSMILHELTDLKELHEDLQLQFEDVSAQKEKFEANILQLSSDLNAKMLDCAQLED 327
            |       :||.....:|:::::.:..:..||..|....||.|.|:.:                 
Human   144 EQKVQLHLLAKEDYHKQLSEIEKYYATITGQFGLVKENHEKLEQNVRE----------------- 191

  Fly   328 RIEQLPIEANKALSKLQRDLEA------SELQFVDQQRLTDQATRELELVRNEINTFKTLIEEKE 386
                 .|::||.||.|.:..||      .||:......:..:.|.:.::....||.  |:.|:| 
Human   192 -----AIQSNKRLSALNKKQEAEICSLKKELKKAASDLIKSKVTCQYKMGEENINL--TIKEQK- 248

  Fly   387 RRHVSLSDELTQMTERLSELADINESYINELTETKLKHSQEIK-DQADAYEIVVQELKESL---N 447
                     ..::.|||:...::||....|:|     |.||.| |...:::.:.|.|::.:   .
Human   249 ---------FQELQERLNMELELNEKINEEIT-----HIQEEKQDIIISFQHMQQLLRQQIQANT 299

  Fly   448 KASVDFTQLKSNSEKLHKETLLQ---VSELQEKLIEMVSH--------RSNQEEL---IKRLGNE 498
            :...:...||.|::.|.::..||   |.|.:||.:.:.:.        :.:.|||   |.::.||
Human   300 EMEAELKVLKENNQTLERDNELQREKVKENEEKFLNLQNEHEKALGTWKRHAEELNGEINKIKNE 364

  Fly   499 IQ--EKTH--------------NFEEELKRQQEQLANQMQMKATEVESENKRNAVEIQKLKSELE 547
            :.  ::||              .|||:.|.|.....|.   :.:|:.:|...|.: |||..:|.|
Human   365 LSSLKETHIKLQEHYNKLCNQKTFEEDKKFQNVPEVNN---ENSEMSTEKSENTI-IQKYNTEQE 425

  Fly   548 ERNK---------AFKAQQDKL------EYLISDHDTLKSAI---INLQAEKKEIESELSTAK-V 593
            .|.:         .::.:::|.      |.:|.|....:.:.   |:....:.|.:||:|.:| :
Human   426 IREENMENFCSDTEYREKEEKKEGSFIEEIIIDDLQLFEKSFKNEIDTVVSQDENQSEISLSKTL 490

  Fly   594 KFSEEL--QSQKDNLMKKVSELELEIKRK--------------------------ETELIELERE 630
            ...:|:  |.|..|:......:..|||.|                          |||.|.|||.
Human   491 SLDKEVISQGQTSNVTDNRKSVTTEIKDKICLEKDNGCTEFKSPNNHFVVLDTAIETEKIHLERT 555

  Fly   631 KNNEM----AVLQFKMNR--INCLIDQPVTTIKQLKDSKGPTRTESIPTKVQPENTDEFSSTARK 689
            :..::    ..|:.:.|:  .|.::::   |......:.....:|:.|.|       :|......
Human   556 RGLDVHHTDVNLEVENNKTSFNSILNE---TAHNTYHNNNKDVSENEPFK-------QFRLLPGT 610

  Fly   690 RNARRQKITTYS----SDFDSGDDI 710
            |....:|..|.|    :|.||..||
Human   611 REHALEKEITNSDQTKADLDSSLDI 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c(3)GNP_650490.1 iSH2_PI3K_IA_R 363..>516 CDD:304922 43/186 (23%)
CCDC73NP_001008392.2 CCDC73 27..1070 CDD:292446 148/707 (21%)
BAR <47..220 CDD:299863 48/213 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1052..1079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.