DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and IMA4

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_012314.1 Gene:IMA4 / 853235 SGDID:S000003757 Length:589 Species:Saccharomyces cerevisiae


Alignment Length:360 Identity:79/360 - (21%)
Similarity:126/360 - (35%) Gaps:113/360 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WDD---IAAECENFLGPNGYAGVQVSPVNENAVKDSRPWWERYQPISYK--LETRSGNEEQFASM 98
            |.|   ||::.| ::...|...:.:||..::...|.     .|...:|:  ..|...||:.|| :
Yeast    36 WGDMKGIASKLE-YIKELGTDAIWISPFYDSPQDDM-----GYDIANYEKVWPTYGTNEDCFA-L 93

  Fly    99 VKRCNAVGVRTYVDVVFNHMAAD-------------------------GGTYGTGGSTASPSS-K 137
            :::.:.:|::...|:|.||.:::                         |  |...|....|:: :
Yeast    94 IEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKG--YDAEGKPIPPNNWR 156

  Fly   138 SYPGVPYSSLD-----FNPTCAISNYNDAN-EVRNCELVGLRDLNQGNSYVQDKVVEFLDHLIDL 196
            ||.|....:.|     |......|...|.| |..:|.          .:..:..|..:|||    
Yeast   157 SYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCR----------KAIYESAVGYWLDH---- 207

  Fly   197 GVAGFRVDA----AKHMWPADLAVIYGRLKNLNTD---------HGFASGSKAYIVQEVIDMGGE 248
            ||.|||:|.    :|.....|..||....|...:|         |.|......:|...|.| |.|
Yeast   208 GVDGFRIDVGSLYSKVAGLPDAPVIDENSKWQLSDPFTMNGPRIHEFHQEMNKFIRNRVKD-GRE 271

  Fly   249 AISKSE-----------YTG-----LGAITEFRHSD-SIGKVFRGKDQLQY-LTNWGTA------ 289
            .::..|           ||.     |..:..|.|:| .....|| ::.:.| |.:|..|      
Yeast   272 IMTVGEMRHATDETKRLYTSASRHELSELFNFSHTDVGTSPKFR-QNLIPYELKDWKVALAELFR 335

  Fly   290 -------WGFAASDRSLVFVDNHDNQRGHGAGGAD 317
                   |       |.::::|||..|.....|.|
Yeast   336 YVNGTDCW-------STIYLENHDQPRSITRFGDD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 79/360 (22%)
Alpha-amylase 54..342 CDD:278554 74/342 (22%)
Aamy_C 405..493 CDD:214749
IMA4NP_012314.1 AmyAc_SI_OligoGlu_DGase 16..503 CDD:200472 79/360 (22%)
Malt_amylase_C 514..585 CDD:406946
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342131
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.