DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Amy-p and slc3a2a

DIOPT Version :9

Sequence 1:	NP_001286518.1	Gene:	Amy-p / 47764	FlyBaseID:	FBgn0000079	Length:	494	Species:	Drosophila melanogaster
Sequence 2:	NP_571676.2	Gene:	slc3a2a / 796322	ZFINID:	ZDB-GENE-000831-3	Length:	485	Species:	Danio rerio

Alignment Length:	133	Identity:	28/133 - (21%)
Similarity:	49/133 - (36%)	Gaps:	32/133 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   377 SGGWVCEHRWRQIYNMVAFRNTVG-----------------LDEIQNWWDNG-----SNQISFSR 419
            :.||| ..||..:  ::.:...||                 :.|: :||:.|     ||..:||:
Zfish    62 TAGWV-RTRWALL--VLFWLGWVGMLAGAIVIIVQAPRCKPIPEM-HWWNEGPLYQISNLDAFSK 122

  Fly   420 -GSRGFVAFNNDNYDLNSSLQT-GLPAGTYCDVISGSKSGSSCTGKTVTVGSDGRASIYIGSSED 482
             |.:|.    .:..|..|.::. ||..|....|.:...|....|......||:...:..:..:..
Zfish   123 NGLKGV----EEKLDYLSQMKVKGLVLGPVHSVQADQSSALELTSINPDFGSESELTSLLDRAHR 183

  Fly   483 DGV 485
            .|:
Zfish   184 KGI 186

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Amy-p	NP_001286518.1	AmyAc_bac_euk_AmyA	28..399	CDD:200456	5/21 (24%)
		Alpha-amylase	54..342	CDD:278554
		Aamy_C	405..493	CDD:214749	20/88 (23%)
slc3a2a	NP_571676.2	SLC3A2_N	42..111	CDD:292647	11/52 (21%)
		AmyAc_SLC3A2	94..396	CDD:200483	21/98 (21%)
		AmyA	125..445	CDD:223443	12/66 (18%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0366
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900