DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and zgc:158423

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001073552.1 Gene:zgc:158423 / 790938 ZFINID:ZDB-GENE-061215-58 Length:480 Species:Danio rerio


Alignment Length:355 Identity:73/355 - (20%)
Similarity:117/355 - (32%) Gaps:132/355 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SGRSGMVHLFEWKWDDIAAECENFLGPNGYAGVQVSPVNENAVKDSRPWWERYQPISYKLETRSG 90
            ||..|:    |.|.|        :|.....|||.:.|::...:..    .:....||.:.|.  |
Zfish   110 SGLKGL----EGKLD--------YLSQMNVAGVVLGPIHSLKIDQ----LDTLNLISVQSEV--G 156

  Fly    91 NEEQFASMVKRCNAVGVRTYVDVV---------FNHMAA------DGGTYGTGGSTASPSSKSYP 140
            .|.:..|::...:..|:...:::.         ||:..|      |..||..        .|...
Zfish   157 TENELESLLGLAHKKGIFIVLNLTPNFNKTSAWFNNFNAVAEKIKDACTYWL--------DKGLD 213

  Fly   141 GVPYSSLDFNPTCA------ISNYNDA---------------NEVR--------NCELVGLRDLN 176
            |:..|.|:..||.|      |.|.:||               |::.        :..|.|..||:
Zfish   214 GIFLSDLNEIPTDAWPSIKEIFNRSDATKEVALMGSVNSMSVNDISVLLNRSGVDLLLTGQPDLS 278

  Fly   177 QGNSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMWPADLAV-----IYGRLKNLNTDHG---FASG 233
            .... .|.::::..:..|.....|:|    ....|..||.     :|..|  |.|..|   |::|
Zfish   279 DSGE-KQAQIIKEFNSSIQQTSLGWR----SRQDPGTLAAEFPIRLYQIL--LFTLPGTPVFSAG 336

  Fly   234 -------------------------SKAYIVQE-----------VIDMGGE--AISKSEYTGLGA 260
                                     :||..:||           :.|:.|:  ::...||.||. 
Zfish   337 EELGLKAEEQLQALWDLENPVEEKNAKAKALQEERLAVRNFFKTLSDLRGKERSLQHGEYVGLS- 400

  Fly   261 ITEFRHSDSIGKVFRGKDQ-LQYLT--NWG 287
                 :|.|.....|..|| .:::|  |||
Zfish   401 -----NSKSSLAFLRVWDQSKRFITALNWG 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 71/353 (20%)
Alpha-amylase 54..342 CDD:278554 66/327 (20%)
Aamy_C 405..493 CDD:214749
zgc:158423NP_001073552.1 SLC3A2_N 29..98 CDD:292647
AmyAc_family 81..391 CDD:298606 60/313 (19%)
AmyA 99..446 CDD:223443 73/355 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.