DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and SLC3A2

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001012680.1 Gene:SLC3A2 / 6520 HGNCID:11026 Length:631 Species:Homo sapiens


Alignment Length:308 Identity:57/308 - (18%)
Similarity:98/308 - (31%) Gaps:107/308 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GVQVSPVNENAVKDSRPWWERYQPISYKLETRSGNEEQFASMVKRCNAVGVRTYVDVVFNHMAAD 121
            |:.:.|:::|...|..      |....:::...|::|.|.|:::......:|..           
Human   259 GLVLGPIHKNQKDDVA------QTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVI----------- 306

  Fly   122 GGTYGTGGSTASPSSKSYPGVPYSSLDFNPTCAISNYNDANEVRNCELVGLRDLNQGNSYVQDKV 186
                                     ||..|     ||...|...:.::          ..|..||
Human   307 -------------------------LDLTP-----NYRGENSWFSTQV----------DTVATKV 331

  Fly   187 VEFLDHLIDLGVAGFRVDAAKHMWPAD--LAVIYGRLKNLNTDHGFASGSKAYIVQEVID----- 244
            .:.|:..:..||.||:|...:::..|.  ||......|..:.|....:|:.:..:|:::.     
Human   332 KDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESN 396

  Fly   245 ----MGGEAISKSEYTGLGAITEFRHSDSIGKVFRGKDQLQYLTNWGTAW-GFAASDRSLVFVDN 304
                :....:|.|..||       .|:.|:        ..|||...|..| .::.|.        
Human   397 KDLLLTSSYLSDSGSTG-------EHTKSL--------VTQYLNATGNRWCSWSLSQ-------- 438

  Fly   305 HDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFTD 352
                       |.:||..:|.|.......||....|||    .||:.|
Human   439 -----------ARLLTSFLPAQLLRLYQLMLFTLPGTP----VFSYGD 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 57/308 (19%)
Alpha-amylase 54..342 CDD:278554 52/296 (18%)
Aamy_C 405..493 CDD:214749
SLC3A2NP_001012680.1 SLC3A2_N 161..225 CDD:292647
AmyAc_SLC3A2 208..537 CDD:200483 57/308 (19%)
AmyA 238..597 CDD:223443 57/308 (19%)
DUF3459 520..625 CDD:288769
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.