DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and slc3a1

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_021336428.1 Gene:slc3a1 / 557757 ZFINID:ZDB-GENE-090313-225 Length:674 Species:Danio rerio


Alignment Length:465 Identity:93/465 - (20%)
Similarity:158/465 - (33%) Gaps:143/465 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VQVSPVNENAVKDSRPWWERYQPISYKLETRSGNEEQFASMVKRCNAVGVRTYVDVVFNHMAADG 122
            :.:||..::.::|.....|.::.:    :...|..|.|..::...:..|::..:|.:.||.:...
Zfish   150 IWISPFYKSPMRDFGYDVEDFRDV----DPLFGTMEDFDDLLTSMHDKGLKLIMDYIPNHTSDKH 210

  Fly   123 GTYGTGGSTASPSSKSYPGVPYSSLDFNPTCAISNYNDA----NEVR-NCE----LVGLRDLNQG 178
            ..:....:...|.:..|..|..:: |.:|...:|.:.::    :|:| .|.    |....|||..
Zfish   211 VWFQLSRNYTEPYTDYYIWVNCTA-DKHPNNWVSVFGNSTWEYDEIRQQCYFHQFLKEQPDLNYR 274

  Fly   179 NSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMWPA--------------------------DLAVI 217
            |..|..::.:.:...:..||.|||:||.|||..|                          |....
Zfish   275 NPLVLQEMTDIIHFWLKKGVDGFRMDAVKHMLEATHLRDEPQVNPDQDPSTVDTEFELYHDYTYT 339

  Fly   218 YGRLKNLNTD-------HGFASGSKAYIVQEVIDMGGEAISKS-EYTGLGAITEF---------- 264
            ...|..:.||       :....|...::|.|..|.  |.|.|: .|.|.....|.          
Zfish   340 QAGLHEILTDWRIQMDTYSREPGRYRFMVMESYDY--EEIDKTMRYYGTNYAKESDFPFNFYLLD 402

  Fly   265 -------RHSDSI-----GKVFRGKDQLQYLTNWGTAWGFAASDRSLVFVDNHDNQR-GHGAGGA 316
                   .::.||     ..:.:||     ..||              .|.|||..| |..||  
Zfish   403 LPDNLSGNYAKSIVERWMSNMPKGK-----WPNW--------------VVGNHDKPRIGSSAG-- 446

  Fly   317 DVLTYKVPKQYKMASAFMLAHPFGTPRVM--SSFSFTDTD----QGP-----PTTDGHNIASPI- 369
                    |:|..|...:|....|||...  ......|.:    |.|     |:.......:|: 
Zfish   447 --------KEYVRALNMLLLTLPGTPTTYYGEEIGMVDVNISVIQDPAGQYDPSKSRDPQRTPMQ 503

  Fly   370 FNSD------NSCSGGWVCEHRWRQIYNMVAFRNTVGLDEIQNWWDNGSNQISFSRG-------- 420
            :|::      .|.:|.|:         ::.:...||.: |:|.  |:.|:.||..|.        
Zfish   504 WNNELNAGFSESLNGTWL---------DIASDYRTVNV-EVQQ--DDTSSTISQYRALSLLRSSN 556

  Fly   421 ---SRGFVAF 427
               |||:..:
Zfish   557 VILSRGWFCY 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 81/424 (19%)
Alpha-amylase 54..342 CDD:278554 70/349 (20%)
Aamy_C 405..493 CDD:214749 9/34 (26%)
slc3a1XP_021336428.1 SLC3A2_N 55..113 CDD:318284
AmyAc_SLC3A1 106..563 CDD:200494 92/460 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.