DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and Slc3a2

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_062156.2 Gene:Slc3a2 / 50567 RGDID:3073 Length:566 Species:Rattus norvegicus


Alignment Length:474 Identity:89/474 - (18%)
Similarity:153/474 - (32%) Gaps:188/474 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ECENFLGP--NGYAGVQ---------------VSPVNENAVKDSRPWWERYQPISYKLETRSGNE 92
            :.:.|:||  .|.||::               :.|:::|. ||     |..:....:::...|::
  Rat   161 DLQAFVGPEARGIAGLKNHLEYLSTLKVKGLVLGPIHKNQ-KD-----EVNETDLKQIDPDLGSQ 219

  Fly    93 EQFASMVKRCNAVGVRTYVDVVFNHMAADGGTYGTGGSTASPSSKSYPGVPYSSLDFNPTCAISN 157
            |.|..:::                                |...||.    :..||..|     |
  Rat   220 EDFKDLLQ--------------------------------SAKKKSI----HIILDLTP-----N 243

  Fly   158 YNDANE---VRNCELVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMWPAD--LAVI 217
            |...|.   ....::|..:.....:|::||            ||.||:|.....:..|.  ||..
  Rat   244 YKGQNAWFLPPQADIVATKMKEALSSWLQD------------GVDGFQVRDVGKLANASLYLAEW 296

  Fly   218 YGRLKNLNTDHGFASGSKAYIVQEVID---------MGGEAISKSEYTGLGAITEFRHSDSIGKV 273
            ....||.:.|....:|:.:..:|::::         :....:|:..:||       .|::.:   
  Rat   297 QNITKNFSEDRLLIAGTASSDLQQIVNILESTSDLLLTSSYLSQPVFTG-------EHAELL--- 351

  Fly   274 FRGKDQLQYLTNWGTAW-GFAASDRSLVFVDNHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAH 337
                 .::||...|:.| .::.|.                   |.:||..:|.|:......:|..
  Rat   352 -----VIKYLNATGSRWCSWSVSQ-------------------AGLLTSFIPAQFLRLYQLLLFT 392

  Fly   338 PFGTPRVMSSFSFTDTDQG--PPTTDGHNIASPIF---NSDNSCSGGWVCEHRWRQIYNMVAFRN 397
            ..|||    .||:.| :.|  .....|..:.:|..   .|.||            |..:.|:...
  Rat   393 LPGTP----VFSYGD-ELGLQAVALPGQPMEAPFMLWNESSNS------------QTSSPVSLNM 440

  Fly   398 TV-GLDEIQNWWDNGSNQISFSR--------------------GSRGFVAF-----NNDNY---- 432
            || |.:|     |.||....|.|                    .|.|..::     .|:.|    
  Rat   441 TVKGQNE-----DPGSLLTQFRRLSDLRGKERSLLHGDFDALSSSSGLFSYVRHWDQNERYLVVL 500

  Fly   433 ---DLNSSLQTG---LPAG 445
               |:..|.:.|   ||||
  Rat   501 NFQDVGLSARVGASNLPAG 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 69/390 (18%)
Alpha-amylase 54..342 CDD:278554 53/317 (17%)
Aamy_C 405..493 CDD:214749 16/76 (21%)
Slc3a2NP_062156.2 SLC3A2_N 85..156 CDD:292647
AmyAc_family 139..469 CDD:298606 78/422 (18%)
AmyA 159..514 CDD:223443 85/467 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.