DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and Mal-A2

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_476625.2 Gene:Mal-A2 / 35825 FlyBaseID:FBgn0002569 Length:567 Species:Drosophila melanogaster


Alignment Length:485 Identity:91/485 - (18%)
Similarity:161/485 - (33%) Gaps:165/485 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FLGPNGYAGVQVSPVNENAVKDSRPWWERYQPIS--YKLETRSGNEEQFASMVKRCNAVGVRTYV 111
            :|...|.....:||:..:.:.|..      ..||  |.::...|..|.|..::....::||:..:
  Fly    61 YLKEIGITATWLSPIFTSPMSDFG------YDISNFYDIDPIFGTLEDFDDLIVEAKSLGVKIIL 119

  Fly   112 DVVFNHMA----------------------ADGGTYGTGGSTASPSSKSYPGVPYSSLDFNPTCA 154
            |.|.||.:                      .||......|:...||:       :.|:...|   
  Fly   120 DFVPNHSSDENVWFEKSVNREDGYDDFYVWDDGKLNEETGARDPPSN-------WVSVFSGP--- 174

  Fly   155 ISNYNDANEVRNCELVGLR--DLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMWPADLAVI 217
            :..:|:..:........::  |||..|..|::.:::.|...:|.||.|||:||..|::       
  Fly   175 MWTWNEKRQQYFLHQFQVKQPDLNFTNPMVREHMLDVLKFWLDRGVDGFRIDAVPHIY------- 232

  Fly   218 YGRLKNLNTDHGFASGSKAYIVQEVIDMGGEAISKSEYTGLGAITEFRHSDSIGKVFRGKDQ--- 279
                     :|..|.||  |..:.|...|.:.            ..:.:.|.|    ..|||   
  Fly   233 ---------EHRNADGS--YPDEPVSGWGSDP------------NAYDYHDHI----YTKDQPAT 270

  Fly   280 LQYLTNWGTAWGFAASDRSLVFVDNHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRV 344
            :..:..|..            |:||:..|.|   |.:.||               ||..:.:...
  Fly   271 VDLMYEWRE------------FLDNYRAQNG---GDSRVL---------------LAEAYSSVET 305

  Fly   345 MSSFSFTDTDQGPPT--------TDGHNIASPIFNSDNSCSGGWVCEHRWRQIYNMVAFRNTVGL 401
            :|::....|.||...        ..|::.|..:..|.:.    |: ...|::             
  Fly   306 LSAYFGNSTHQGTQLPMNFQLMYLSGYSTAKDVVGSIDY----WM-NTMWKE------------- 352

  Fly   402 DEIQNW--WDNGSNQISFSRGSRGFVAFNNDNYDLNSSLQTGLPAGT---YCDVISGSKSGSSCT 461
            .:..||  .::.:|:::...|:.        ..||.:.:...||..:   |.:.|..|.....||
  Fly   353 HQTANWVVGNHDTNRVADRMGAH--------KVDLLNVIVNALPGASVTYYGEEIGMSNVDVECT 409

  Fly   462 GKTV------------TVG-----SDGRAS 474
            |.:.            |.|     |||.::
  Fly   410 GDSCEDRDGERTPMQWTAGKNADFSDGEST 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 72/386 (19%)
Alpha-amylase 54..342 CDD:278554 62/316 (20%)
Aamy_C 405..493 CDD:214749 19/92 (21%)
Mal-A2NP_476625.2 AmyAc_maltase 24..484 CDD:200467 91/485 (19%)
Alpha-amylase 50..405 CDD:278554 83/449 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.