DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and Mal-B2

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001188791.2 Gene:Mal-B2 / 34598 FlyBaseID:FBgn0032382 Length:583 Species:Drosophila melanogaster


Alignment Length:479 Identity:92/479 - (19%)
Similarity:162/479 - (33%) Gaps:161/479 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FLGPNGYAGVQVSPVNENAVKDSRPWWERYQPISYK-LETRSGNEEQFASMVKRCNAVGVRTYVD 112
            :|...|.....:||:.::.:.|.     .|....|| ::...|..:.|..::.....:|::..:|
  Fly    68 YLADTGITATWLSPIFQSPMIDF-----GYDISDYKAIQPEYGTMQDFEELIDTAFELGIKVVLD 127

  Fly   113 VVFNHMAAD---------------------GGTYGTGGSTASPSSKSYPGVPYSSLDFNPTCAIS 156
            .|.||.:..                     .|.....|:...|:  ::|.|.|.|        ..
  Fly   128 FVPNHSSDQHEWFKKSAAREPGYEDFYVWHDGIVQENGTRVPPN--NWPSVFYGS--------AW 182

  Fly   157 NYNDANEVRNCELVGLR--DLNQGNSYVQDKVVEFLDHL----IDLGVAGFRVDAAKHMWPADLA 215
            .:::..|..........  |||    |...|||:.:|.:    ::.||||||:||..|:: .|.:
  Fly   183 EWHEGREQYYLHQFTKEQPDLN----YRNPKVVQAMDDVLLFWLNKGVAGFRIDAVNHLF-EDES 242

  Fly   216 VIYGRLKNLNTD---HGFASGSKAYIVQEVIDM------------------GGEAISKSEYTGLG 259
            :....|....||   :.:.....:..:.||::|                  ....:....|.||.
  Fly   243 LKDEPLSGKTTDSLSYDYTKHIYSRDLPEVLEMIHHWRQLLDDFSAKHPERPTRIMMTEAYAGLT 307

  Fly   260 AITEFRHSDSIGKVFRG----------------KDQLQYLTNWGTAWGFAASDRSLVFVDNHDNQ 308
            .:.:: :.||.|  .||                .|...|:.|         .::.|:::     .
  Fly   308 QLADY-YEDSNG--VRGSHLPFNFHFITDVKGDSDARDYVYN---------VEKWLIYM-----P 355

  Fly   309 RGHGA----GGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFTDTDQGPPTTDGHNI---- 365
            |||.|    |..|                       .|||.|.|       ||.:.|..|:    
  Fly   356 RGHAANWVMGNHD-----------------------NPRVASRF-------GPASVDAMNMLLLT 390

  Fly   366 ---ASPIFNSDNSCSGGWVCEHR---WRQIYNMVAFRNT-------VGLDEIQN--WWDNGSNQI 415
               .:..:|.:..   |.| ::|   |.:..:..| ||.       |..|.::.  .|:|.:| .
  Fly   391 LPGVAVTYNGEEL---GMV-DYRELSWEETVDPPA-RNVGEKLYQEVSRDPVRTPFQWNNETN-A 449

  Fly   416 SFSRGSRGFVAFNNDNYDLNSSLQ 439
            .||..::.::..:.:..:||...|
  Fly   450 GFSTAAKTWLPVHPNYLELNLEAQ 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 82/435 (19%)
Alpha-amylase 54..342 CDD:278554 64/356 (18%)
Aamy_C 405..493 CDD:214749 8/37 (22%)
Mal-B2NP_001188791.2 AmyAc_maltase 33..502 CDD:200467 92/479 (19%)
Malt_amylase_C 510..>541 CDD:351862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443612
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.