DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and Mal-B1

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster


Alignment Length:481 Identity:86/481 - (17%)
Similarity:151/481 - (31%) Gaps:184/481 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GYAGVQVSPVNENAVKDSRPWWERYQPISY-KLETRSGNEEQFASMVKRCNAVGVRTYVDVVFNH 117
            |...|.:||:.|:.:.|.     .|...:| .::...|..|.|.:::.:.|.:||:..:|.|.||
  Fly    72 GITSVWLSPIYESPMVDF-----GYDISNYTNIQPEYGTLEDFDALIAKANELGVKVILDFVPNH 131

  Fly   118 MAA---------------------DGGTYGTGGSTASPSS--KSYPGVPYSSLDFNPTCAISNYN 159
            .:.                     :.|.....|:...|::  ..:.|..:.            :|
  Fly   132 SSNKHPWFIKSVAREPGYEDFYVWEDGILLENGTRVPPNNWLSVFSGSAWM------------WN 184

  Fly   160 DANE---VRNCELVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMW----------- 210
            |..:   :|.. ..|..|||..|..|...:.:.:...::.|:||||:||..:::           
  Fly   185 DERQQYYLRQF-TYGQPDLNYRNPAVIKAMDDVMLFWLNKGIAGFRIDAIIYIYEDAQLRDEPPS 248

  Fly   211 --------PADLAVIYGR---------------LKNLNTDH----------GFASGSKAYIVQEV 242
                    .|.|:.||.|               |.|...:|          |:||.|:  :::..
  Fly   249 GTTDDPNNEAYLSHIYTRNQPEDYGLLQHWRQLLDNYTANHDGPLRIMMTEGYASVSQ--LMEYY 311

  Fly   243 IDMGGEAISKSEYT-GLGAITEFRHSDSIGKVFRGKDQLQYLTNWGTAWGFAASDRSLVF----- 301
            .|..|  :...::. ....|||...:.:      ..|.:.|::.|            |::     
  Fly   312 EDSNG--VQGPQFPFNFDFITELNANST------AADFVFYISRW------------LIYMPHGH 356

  Fly   302 -----VDNHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFTDTDQGPPTTD 361
                 :.||||                                  |||.|.|       |..:.|
  Fly   357 VANWVMGNHDN----------------------------------PRVASRF-------GEKSVD 380

  Fly   362 GHNIASPIFNSDNSCSGGWVCEHRWRQIYNMVAFRNTV-------GLDEIQN----------WWD 409
            ..|:.............|   |......|..:::.:||       |:|..:.          .|.
  Fly   381 AMNMLLMTLPGIGITYNG---EELGMTDYRDISWSDTVDQPACEAGIDNYKTISRDPERTPMQWS 442

  Fly   410 NGSNQISFSRGSRGFVAFNNDNYDLN 435
            :..| ..||...|.::..|.:..:||
  Fly   443 SDVN-AGFSSADRTWLPVNPNYKELN 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 74/426 (17%)
Alpha-amylase 54..342 CDD:278554 63/369 (17%)
Aamy_C 405..493 CDD:214749 8/41 (20%)
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 86/481 (18%)
trehalose_treC 33..538 CDD:274115 86/481 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443613
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.