DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and Mal-A6

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_724679.2 Gene:Mal-A6 / 246565 FlyBaseID:FBgn0050360 Length:601 Species:Drosophila melanogaster


Alignment Length:529 Identity:102/529 - (19%)
Similarity:173/529 - (32%) Gaps:162/529 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NFLGPNGYAGVQVSPVNENAVKDSRPWWERYQPIS--YKLETRSGNEEQFASMVKRCNAVGVRTY 110
            ::|...|.....:||:.      |.|..:....||  :.::...|....|..::.......::..
  Fly    76 DYLKEIGVTATWLSPIY------SSPMADFGYDISDFFDIQPEYGTLADFDELIAEAKKRNIKII 134

  Fly   111 VDVVFNH----------------------MAADGGTYGTGGSTASPSS--KSYPGVPYSSLDFNP 151
            :|.|.||                      |..||....|.|....||:  :::.|..:       
  Fly   135 LDFVPNHSSDENVWFQKSVKREKGYEDYYMWHDGYVNATTGKREPPSNWLQAFRGSAW------- 192

  Fly   152 TCAISNYNDANEVRNCELVGLR--DLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMW---- 210
                 .:||..:........::  |||..|..|..::...|.:.:|.||||||:||..  |    
  Fly   193 -----EWNDERQQYYLHQFAVKQPDLNYRNPAVVAQMKRVLTYWLDRGVAGFRMDAVP--WCFEV 250

  Fly   211 --PADLAVIYGR-----LKNLNTDHGFASGSKAYIVQ---EVIDM---------------GGE-- 248
              .||     ||     |.....|...:|..|....|   |.::|               ||:  
  Fly   251 LPDAD-----GRYPDEPLSGYTDDPDDSSYLKHIYTQDLRETVEMVFQWRTLLDDYQRIHGGDTR 310

  Fly   249 AISKSEYTGLGAITEFRHSDSI--------------GKVFRGKDQL------QYLTNWGTAWGFA 293
            .|....|:||..:.:|..:.:.              |...:...||      :.:::|.:.  ..
  Fly   311 VIMVETYSGLDYVMQFYGNRTTKGAQMPFNFQFIIGGNGDKNNTQLNATGFVKIISSWLSQ--MP 373

  Fly   294 ASDRSLVFVDNHDNQR---GHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFTD--- 352
            |...:...:.|||.:|   .:|....|::        .|...|:       |.|..::...:   
  Fly   374 AGQTANWVMGNHDQRRVGSRYGENRIDLM--------NMLQMFL-------PGVSITYQGEELGM 423

  Fly   353 TDQGPPTTDGHNIASPIFNSDNSCSGGWVCEHRWRQIYNMVAFRNTVGLDEIQNWWDNGSNQISF 417
            ||......|..:.|:...|||               ||..  |.........|  |.:.:| ..|
  Fly   424 TDLDISWEDSRDPAACNSNSD---------------IYEQ--FTRDPARTPFQ--WSDEAN-AGF 468

  Fly   418 SRGSRGFVAFNNDNYDLNSSLQTGL-PA--GTYCDVISGSKSGSSCTGKTVTVGSDGRASIYIGS 479
            |..:..::..|.:...:|:..:... |:  ..|..::...||      ||:..|:...|::    
  Fly   469 STNATTWLPINPNYVTVNAKAENSTSPSHLSLYKQLVDLRKS------KTLQFGATRYANV---- 523

  Fly   480 SEDDGVLAI 488
              .|.|:||
  Fly   524 --GDNVVAI 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 83/435 (19%)
Alpha-amylase 54..342 CDD:278554 70/369 (19%)
Aamy_C 405..493 CDD:214749 19/87 (22%)
Mal-A6NP_724679.2 AmyAc_maltase 40..516 CDD:200467 96/507 (19%)
trehalose_treC 43..599 CDD:274115 102/529 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443611
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.