DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and Slc3a1

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_033231.2 Gene:Slc3a1 / 20532 MGIID:1195264 Length:685 Species:Mus musculus


Alignment Length:446 Identity:91/446 - (20%)
Similarity:153/446 - (34%) Gaps:132/446 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ENAVKDSRPWWERYQPISYKLETRSGNEEQFASMVKRCNAVGVRTYVDVVFNHMAADGGTYGTGG 129
            ::::||.|...|.::    :::...|..:.|.::|...:..|::..:|.:.|| .:|...:....
Mouse   166 KSSLKDFRYAVEDFK----EIDPIFGTMKDFENLVAAIHDKGLKLIIDFIPNH-TSDKHPWFQSS 225

  Fly   130 STASPSSKSYPGVPY--------SSLDFNPTCAISNYNDA----NEVR-NCE----LVGLRDLNQ 177
            .|.|.....|    |        :.:...|...:|.|.::    :||| .|.    |....|||.
Mouse   226 RTRSGKYTDY----YIWHNCTHVNGVTTPPNNWLSVYGNSSWHFDEVRKQCYFHQFLKEQPDLNF 286

  Fly   178 GNSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMWPA---------------DLAVIYGRLKNLNTD 227
            .|..||:::.|.:...:..||.||..||.|.:..|               |....|..|.     
Mouse   287 RNPAVQEEIKEIITFWLSKGVDGFSFDAVKFLLEAKDLRNEIQVNTSQIPDTVTHYSELY----- 346

  Fly   228 HGFASGSKAY--IVQEVID--------------MGGEAISKS-----EYTGLGAITE--FRHSDS 269
            |.|.:.....  ||::...              ||.||.::|     .|.||..|.|  |..:  
Mouse   347 HDFTTTQVGMHDIVRDFRQTMNQYSREPGRYRFMGAEASAESIERTMMYYGLPFIQEADFPFN-- 409

  Fly   270 IGKVFRGKDQLQYLTNWGTAWGFAASDRSLVFVDNHDNQRGHG--AGGADV--LTYKVPKQYKMA 330
                       :|.|..||..|....:....:::|....:...  .||.:.  ||.:|..:|..|
Mouse   410 -----------KYFTTIGTLSGHTVYEVITSWMENMPEGKWPNWMTGGPETPRLTSRVGSEYVNA 463

  Fly   331 SAFMLAHPFGTPRV-------MSSFSFTDTDQGPPTTDGHNIASPIFNSDNSCSGGWVCEHRWRQ 388
            ...:|....|||..       |...|.|:                 ||.                
Mouse   464 MHMLLFTLPGTPITYYGEEIGMGDISVTN-----------------FNE---------------- 495

  Fly   389 IYNMVAFRNTVGLDEIQNWWDNGSNQISFSRGSRGFVAFNNDNYDLNSSLQTGLPA 444
                 ::.:|..:.:....|||.|| ..|:..:..::..|:|.:.:|..:|...|:
Mouse   496 -----SYDSTTLVSKSPMQWDNSSN-AGFTEANHTWLPTNSDYHTVNVDVQKTQPS 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 79/399 (20%)
Alpha-amylase 54..342 CDD:278554 72/335 (21%)
Aamy_C 405..493 CDD:214749 11/40 (28%)
Slc3a1NP_033231.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
SLC3A2_N 64..122 CDD:292647
AmyAc_SLC3A1 115..568 CDD:200494 91/446 (20%)
trehalose_treC 116..604 CDD:274115 91/446 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.