DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and LOC1280462

DIOPT Version :10

Sequence 1:NP_536346.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_320158.1 Gene:LOC1280462 / 1280462 VectorBaseID:AGAMI1_002996 Length:599 Species:Anopheles gambiae


Alignment Length:32 Identity:14/32 - (43%)
Similarity:18/32 - (56%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 DLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDA 205
            |||..|..|...:.:.|...:|.||.|||:||
Mosquito   189 DLNYRNPAVVQAMKDVLRFWLDQGVDGFRIDA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_536346.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 14/32 (44%)
Aamy_C 405..493 CDD:214749
LOC1280462XP_320158.1 AmyAc_maltase 21..490 CDD:200467 14/32 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.