DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-p and si:dkey-202g17.3

DIOPT Version :9

Sequence 1:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_001343266.1 Gene:si:dkey-202g17.3 / 100003805 ZFINID:ZDB-GENE-131127-371 Length:487 Species:Danio rerio


Alignment Length:93 Identity:16/93 - (17%)
Similarity:28/93 - (30%) Gaps:32/93 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 MSSFSFTDTDQG-----------PPTTDGHNIASPIFNSD-NSCSGG--------------WVCE 383
            :|...|||.:..           ||.........|:...: ..|:||              |:| 
Zfish    14 VSGARFTDVEGSESVPLLTPGPPPPPPARRRAWKPLSREELERCAGGPQWRKFRRRLVLCFWIC- 77

  Fly   384 HRWRQIYN---MVAFRNTVGLDEIQNWW 408
              |..:..   ::..|:......:.:||
Zfish    78 --WMLLLGAAVLIVIRSPRATSPVLHWW 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 14/82 (17%)
Alpha-amylase 54..342 CDD:278554
Aamy_C 405..493 CDD:214749 2/4 (50%)
si:dkey-202g17.3XP_001343266.1 SLC3A2_N 49..105 CDD:292647 9/58 (16%)
AmyAc_family 93..404 CDD:298606 2/11 (18%)
Alpha-amylase 132..362 CDD:278554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576487
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.