powered by:
Protein Alignment Abd-B and YOX1
DIOPT Version :9
Sequence 1: | NP_001303472.1 |
Gene: | Abd-B / 47763 |
FlyBaseID: | FBgn0000015 |
Length: | 493 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013685.1 |
Gene: | YOX1 / 854981 |
SGDID: | S000004489 |
Length: | 385 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 67 |
Identity: | 27/67 - (40%) |
Similarity: | 40/67 - (59%) |
Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 388 RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQ 452
|:||:..|..:...|:.||......||:||.|||.:..:||:.|:|||||:|...|: ||.|..
Yeast 177 RRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKR--QRIATS 239
Fly 453 QN 454
::
Yeast 240 KS 241
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
49 |
1.000 |
Domainoid score |
I2937 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3844 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.