DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HB18

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_177248.3 Gene:HB18 / 843431 AraportID:AT1G70920 Length:206 Species:Arabidopsis thaliana


Alignment Length:114 Identity:32/114 - (28%)
Similarity:60/114 - (52%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 STSSYEP-PTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRK-PY 394
            |..|:.| |:.....|:|.:.......:.......:||      .|.::|.......|:::| ..
plant    15 SIPSFSPSPSLGDHHGMRDFDINQTPKTEEDREWMIGA------TPHVNEDDSNSGGRRRKKLRL 73

  Fly   395 SKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNK 443
            :|.|:..||:.|:.|..::.:::.:||..|:|::|||::||||||.::|
plant    74 TKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 22/57 (39%)
HB18NP_177248.3 HOX 66..122 CDD:197696 21/55 (38%)
HALZ 124..167 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.