DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HAT14

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_196289.2 Gene:HAT14 / 830560 AraportID:AT5G06710 Length:336 Species:Arabidopsis thaliana


Alignment Length:168 Identity:46/168 - (27%)
Similarity:70/168 - (41%) Gaps:41/168 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 PNYRPDQTTS------AAAAAAYMNEAERHVSAAARQSVE--GTSTSSYEPPTYSSPGGLRGYPS 352
            ||:.|:.:..      ...||..:.|.|....|....||.  .:.|||::     ...|::.|..
plant    97 PNWLPENSKGRQGGRMPLGAATVVEEEEEEEEAVPSMSVSPPDSVTSSFQ-----LDFGIKSYGY 156

  Fly   353 E------------NYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKE 405
            |            ..|:|.||             |....:..|  |.|||.: .||.|:..||..
plant   157 ERRSNKRDIDDEVERSASRAS-------------NEDNDDENG--STRKKLR-LSKDQSAFLEDS 205

  Fly   406 FLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNK 443
            |..::.::.:::..||:.|.|..|||::||||||.:.|
plant   206 FKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 23/56 (41%)
HAT14NP_196289.2 HOX 187..243 CDD:197696 23/56 (41%)
HALZ 245..288 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.