DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HAT1

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:209 Identity:50/209 - (23%)
Similarity:74/209 - (35%) Gaps:61/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 EGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGL---HEWTGQVSVRKK 390
            |.|..||......|:..|.| ..:|...:||...|..:......:.:.|.   .|..|..:.|||
plant    73 EETGVSSPNSTISSTVSGKR-RSTEREGTSGGGCGDDLDITLDRSSSRGTSDEEEDYGGETCRKK 136

  Fly   391 RKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNK-----------K 444
            .: .||.|:..||..|..:..::.:::..||:.|.||.|||::||||||.:.|           |
plant   137 LR-LSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQTEVDCEYLK 200

  Fly   445 NSQRQANQQNNN-------------------------------------NNSSSNHNHAQATQQH 472
            ....:..::|..                                     ..||||||....:   
plant   201 RCVEKLTEENRRLEKEAAELRALKLSPRLYGQMSPPTTLLMCPSCERVAGPSSSNHNQRSVS--- 262

  Fly   473 HSGHHLNLSLNMGH 486
                 |:..|.|.|
plant   263 -----LSPWLQMAH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 21/52 (40%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474 8/25 (32%)
HOX 134..188 CDD:197696 23/54 (43%)
HALZ 190..233 CDD:128634 2/42 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.