DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HB20

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:37 Identity:13/37 - (35%)
Similarity:16/37 - (43%) Gaps:14/37 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NEFDFL------------NHLRG-TIGVP-NIIQHFQ 84
            :|||:.            |..|| |..|| ||.:.||
plant    69 SEFDYTGAVLGDYCYNCRNESRGCTCNVPFNITEFFQ 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649
HB20NP_186771.1 Homeodomain 87..140 CDD:459649 10/19 (53%)
HALZ 142..183 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.