DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HB-1

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_186796.1 Gene:HB-1 / 821138 AraportID:AT3G01470 Length:272 Species:Arabidopsis thaliana


Alignment Length:143 Identity:34/143 - (23%)
Similarity:55/143 - (38%) Gaps:30/143 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 DQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLS 365
            |.:.|...:..::......|.....:|:.....:|...|.:|||..|  |..:.|..        
plant     9 DPSASHGNSMFFLGNLNPVVQGGGARSMMNMEETSKRRPFFSSPEDL--YDDDFYDD-------- 63

  Fly   366 VGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQ 430
                              |:..:|:|  .:..|...|||.|.....:..:::.:||:.|.|..||
plant    64 ------------------QLPEKKRR--LTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQ 108

  Fly   431 VKIWFQNRRMKNK 443
            |.:||||||.:.|
plant   109 VAVWFQNRRARWK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 21/56 (38%)
HB-1NP_186796.1 Homeodomain 68..121 CDD:459649 20/54 (37%)
HALZ 123..164 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.