DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HB22

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_850266.1 Gene:HB22 / 818233 AraportID:AT2G36610 Length:185 Species:Arabidopsis thaliana


Alignment Length:138 Identity:37/138 - (26%)
Similarity:63/138 - (45%) Gaps:32/138 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 VEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASG--GLSVGA------VGPCTPNPGLHE---- 380
            ::|.|:||:..|.|:         .:::|.:..:.  |..:||      |.......|..|    
plant     9 IDGASSSSFISPFYN---------FDHFSGNQDNRCLGTMMGAQQDILHVPLAMVESGYGEESNS 64

  Fly   381 WTGQVSVRKKRKPYS---KFQTLELEKEFLFN----AYVSKQKRWELARNLQLTERQVKIWFQNR 438
            :.||  .:||:|..|   ||.....::|...|    ..::..::.:|::.|.|..||:.:|||||
plant    65 FNGQ--EKKKKKMTSEQLKFLERSFQEEIKLNPDRKMKLNPDRKMKLSKELGLQPRQIAVWFQNR 127

  Fly   439 --RMKNKK 444
              |.|||:
plant   128 KARWKNKQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 21/64 (33%)
HB22NP_850266.1 Homeodomain 70..133 CDD:459649 19/62 (31%)
HALZ 134..167 CDD:460477 1/2 (50%)

Return to query results.
Submit another query.