DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HB17

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:135 Identity:38/135 - (28%)
Similarity:66/135 - (48%) Gaps:15/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 TYSSPGGLRGYPSENYSSSGASGG-----LSVGAVGPCTPNPGLHEWT---GQVSVRKKRKPYSK 396
            |.|.|    |:.|...|..|:.||     |.:..: |.:.:....|::   |....|||.: .::
plant    87 TISVP----GFSSSPLSDEGSGGGRDQLRLDMNRL-PSSEDGDDEEFSHDDGSAPPRKKLR-LTR 145

  Fly   397 FQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNK-KNSQRQANQQNNNNNSS 460
            .|:..||..|..|..::.:::..||::|.|..||:::||||||.::| |.::.:.........|.
plant   146 EQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSL 210

  Fly   461 SNHNH 465
            :..||
plant   211 TEENH 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 21/56 (38%)
HB17NP_178252.2 HOX 136..192 CDD:197696 20/56 (36%)
HALZ 194..237 CDD:128634 4/22 (18%)

Return to query results.
Submit another query.