DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxa5

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_077365.1 Gene:Hoxa5 / 79241 RGDID:620609 Length:381 Species:Rattus norvegicus


Alignment Length:394 Identity:87/394 - (22%)
Similarity:153/394 - (38%) Gaps:115/394 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QQQQQLATTPVAGALSPAQT-PTGPSAQQQQHLTSPHHQQLPQQQTPNSVASGASSNLQQQQQQQ 191
            ::::::|.|....|..|::. ||.|...:   .||..||.        ...:|...::.:.:...
  Rat    14 ERRRRVAGTRPGSARHPSRLHPTPPLLHE---FTSRGHQA--------GFTTGQQKHVIRSRTPY 67

  Fly   192 NAAVAPGQTQIVAPTTA---------SVSPSSVSSQKEDINMSIQLAPLHIPAIRA----GPGFE 243
            ..|.. |..::..|..:         ::...:.:|.|...::..|::...:.:...    ||.::
  Rat    68 LGAYV-GGNRVHVPVISIIHHKLCKGAIDAQTTASHKSSTHIKKQMSSYFVNSFCGRYPNGPDYQ 131

  Fly   244 T----DTSA-------AVKRHTAHWAYNDEGF--------NQHYGSGYYDRKH-----------M 278
            .    |.|:       :...|:..:.|...|.        :.|:|||...|.:           .
  Rat   132 LHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAAGASAAPAEPR 196

  Fly   279 FAYPYPETQFPVGQYWGPNYRPDQTTSAAAA-------------------AAYMNEAERHVSAAA 324
            ::.|...|..|         .||....:|.|                   .|..|....|:|  :
  Rat   197 YSQPATSTHSP---------PPDPLPCSAVAPSPGSDSHHGGKNSLGNSSGASANAGSTHIS--S 250

  Fly   325 RQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTP-NPGLHEWTGQVSV- 387
            |:.|...|.:..:.|..|...|.:..||                  |..| .|.::.|..::.: 
  Rat   251 REGVGTASAAEEDAPASSEQAGAQSEPS------------------PAPPAQPQIYPWMRKLHIS 297

  Fly   388 ---------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNK 443
                     ::.|..|:::|||||||||.||.|:::::|.|:|..|.|:|||:||||||||||.|
  Rat   298 HDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWK 362

  Fly   444 KNSQ 447
            |:::
  Rat   363 KDNK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 32/52 (62%)
Hoxa5NP_077365.1 Homeobox 310..363 CDD:365835 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.