DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxc12b

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571620.1 Gene:hoxc12b / 58062 ZFINID:ZDB-GENE-000329-17 Length:283 Species:Danio rerio


Alignment Length:164 Identity:54/164 - (32%)
Similarity:75/164 - (45%) Gaps:55/164 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 PNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSP----------GGLRGY 350
            ||.|..::..:.:..:::|              ||..|||....:.:||          ||...|
Zfish   159 PNPRLCRSLESVSGCSFIN--------------EGAKTSSGITHSLTSPDIQTSVAALNGGALWY 209

  Fly   351 PSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQ 415
            |                          :|..|     |||||||||.|..|||.||:.|.::::|
Zfish   210 P--------------------------MHRQT-----RKKRKPYSKLQLNELEGEFILNEFITRQ 243

  Fly   416 KRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQ 449
            :|.||:..|.||::||||||||||||.|:...|:
Zfish   244 RRRELSDRLNLTDQQVKIWFQNRRMKKKRLLMRE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 33/52 (63%)
hoxc12bNP_571620.1 Homeobox 218..271 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5302
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.