DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxb10a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571616.1 Gene:hoxb10a / 58056 ZFINID:ZDB-GENE-000328-2 Length:279 Species:Danio rerio


Alignment Length:267 Identity:76/267 - (28%)
Similarity:110/267 - (41%) Gaps:72/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PTTASVSPSSVSSQKEDINM---------SIQLAPLHIPAIRAGPG-----FETDTSAAVKRHTA 255
            |...::.|:..:.|..||:.         |:..|..|.|......|     ..|:|.......::
Zfish    42 PFYFTLDPTGQARQPLDISAFSRIMTDMGSLNSADDHRPETSFYSGHKLLSLNTNTDPESPSLSS 106

  Fly   256 HWAYNDEGFNQHYGS-------GYYDRKHMFAYPYPE-TQFPVGQYWGPNYRPDQTTSAAAAAAY 312
            |   :|   :||..|       ...|.||...|...| |::|  ..|                  
Zfish   107 H---SD---SQHLHSLSLSAPCSETDNKHDMQYLAMESTKYP--SQW------------------ 145

  Fly   313 MNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRG-----YPSENYSSSGASGGLSVGAVGPC 372
             :|:..:.|.....|:...|....||....: ...||     ..:::.:...|:.|         
Zfish   146 -SESRTNRSIITTLSISQRSKDDIEPNNLQT-DFTRGDKTPREKTQDVTLENAANG--------- 199

  Fly   373 TPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQN 437
                    |....:.||||.||||.|.||||||||||.|:::::|.|::|::.||:|||||||||
Zfish   200 --------WLSAKAGRKKRCPYSKHQILELEKEFLFNMYLTRERRLEISRSINLTDRQVKIWFQN 256

  Fly   438 RRMKNKK 444
            ||||.||
Zfish   257 RRMKLKK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 36/52 (69%)
hoxb10aNP_571616.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..112 4/26 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..187 4/20 (20%)
Homeobox 209..262 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7557
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm24582
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.