DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxa4a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571610.1 Gene:hoxa4a / 58050 ZFINID:ZDB-GENE-000823-4 Length:245 Species:Danio rerio


Alignment Length:243 Identity:69/243 - (28%)
Similarity:108/243 - (44%) Gaps:57/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 YNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNE-AERHVSA 322
            |:..|: ....|.||:|.....:|:.|.    ..|...||:.........:...:|: ::||  .
Zfish    23 YHQNGY-MPVSSDYYERPKDPGFPHHEE----ASYPRSNYQEQSYDYGNVSTNDLNDFSDRH--H 80

  Fly   323 AARQSVEGTSTSSYEPPTYSSPGGLRGYPSENY-------SSSGASGGLSVGAVGPCTP------ 374
            |..|||                       |:|:       |..|:.|......|....|      
Zfish    81 AQPQSV-----------------------SQNHGPRLTTESCVGSDGNKDCSLVSDALPGSQKSK 122

  Fly   375 NPGLHEWTGQVSV------------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLT 427
            .|.::.|..:|.|            ::.|..|::.|.|||||||.||.|:::::|.|:|..:.|:
Zfish   123 EPVVYPWMKKVHVNTVTASYSGGVPKRSRTAYTRQQALELEKEFHFNRYLTRRRRVEIAHTMCLS 187

  Fly   428 ERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHN-HAQATQQHHS 474
            ||||||||||||||.||:.:....:..:::::.|||: ...||||..:
Zfish   188 ERQVKIWFQNRRMKWKKDHKLPNTKIRSSSSAPSNHHVKTDATQQQQT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 31/52 (60%)
hoxa4aNP_571610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..99 17/93 (18%)
Antp-type hexapeptide 126..131 1/4 (25%)
Homeobox 150..203 CDD:278475 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..245 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.