DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxa9a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571607.2 Gene:hoxa9a / 58047 ZFINID:ZDB-GENE-000823-1 Length:250 Species:Danio rerio


Alignment Length:241 Identity:82/241 - (34%)
Similarity:114/241 - (47%) Gaps:37/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 IQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFP- 289
            ||..|..:||..:..|..|..:......|:.|.:....|:....|.|          .|..|.| 
Zfish    32 IQHRPTILPADLSDLGPCTFPAKQPVYGTSDWGHIPTHFSTGVPSVY----------QPHAQPPV 86

  Fly   290 VGQY---W------G-PNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSY---EPPTY 341
            ||.|   |      | |...| .|.:...|.:..||.          :.:||..|.:   :|..:
Zfish    87 VGDYVQSWLLDSACGLPQTEP-PTVNHNHAKSDTNET----------NDDGTEYSPHTILQPEVF 140

  Fly   342 SSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEF 406
            ::.|......:|:..::..||.:. |..|....|| :..|....|.||||.||:|.|.|||||||
Zfish   141 TNGGCSTKTEAESSRTAEKSGDIE-GKPGADPENP-VSNWLHASSTRKKRCPYTKHQILELEKEF 203

  Fly   407 LFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQ 452
            |||.|:::.:|:|:||.|.||||||||||||||||.||.::.:..:
Zfish   204 LFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKFNKNETKE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 38/52 (73%)
hoxa9aNP_571607.2 Hox9_act 1..171 CDD:282473 36/160 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 105..177 17/84 (20%)
Homeobox 187..240 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7557
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm24582
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.