DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxb7a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001108563.1 Gene:hoxb7a / 58044 ZFINID:ZDB-GENE-000329-2 Length:227 Species:Danio rerio


Alignment Length:210 Identity:63/210 - (30%)
Similarity:95/210 - (45%) Gaps:43/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 YYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSY 336
            ||.......|....:.|..|.:      |:||:.|.:.::  ..|..:.||:....|..:|:.|.
Zfish     5 YYANALFSKYQVASSAFSTGVF------PEQTSCAFSCSS--QRASGYGSASTGAPVSSSSSVSL 61

  Fly   337 EPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNP----------------------GLH 379
             |..|::...|..:....|.::...|.:|:........:|                      |.|
Zfish    62 -PSMYTNGTSLSSHTQGMYPTAYELGAVSLNMHSSLFDHPNLPMVSAGDLCKAQSSGKEEQRGYH 125

  Fly   380 E----------WTGQVSVRKK--RKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVK 432
            :          |.......:|  |:.||::|||||||||.||.|:|:::|.|:|..|.|||||:|
Zfish   126 QNNENNLRIYPWMRSTGADRKRGRQTYSRYQTLELEKEFHFNRYLSRRRRIEIAHALCLTERQIK 190

  Fly   433 IWFQNRRMKNKKNSQ 447
            |||||||||.||.::
Zfish   191 IWFQNRRMKWKKENK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 36/54 (67%)
hoxb7aNP_001108563.1 Antp-type hexapeptide 134..139 1/4 (25%)
Homeobox 149..201 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..227 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.