DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxc11b

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_009298848.1 Gene:hoxc11b / 570925 ZFINID:ZDB-GENE-000822-3 Length:306 Species:Danio rerio


Alignment Length:353 Identity:96/353 - (27%)
Similarity:139/353 - (39%) Gaps:122/353 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 NSVASGASSNLQQQQQQQNAAV----APGQTQIVAPTTASVSP-SSVSS-----QKEDINMSIQL 228
            |||..|   |...|.:::..:.    |...:.:..|:|..|.. |:|||     |...|..|...
Zfish     3 NSVNIG---NFCSQSRKERTSEFGERASCASNLYLPSTYYVPEFSTVSSFLPQAQSRQITYSYST 64

  Fly   229 APLHIPAIRAGPGFETDTSAAVKRH--------------------------TAHWAYNDEGFNQH 267
            ....:|.:|..| ||.:.|.  |.|                          |.....|:..:|.|
Zfish    65 NFTQVPQVRDLP-FELNPSG--KWHHRGNYSSCYAEEDLVHRDCLPPSATMTEMLMKNENVYNHH 126

  Fly   268 Y--------GSGYYDRKHMFAYPYPETQFPVGQYWGPNYRP-------DQTTSAAAAAAYMN--- 314
            :        |:|:|.              .:|:   .|..|       |...|.|...:..|   
Zfish   127 HYHPAINHPGTGFYS--------------SIGK---TNVLPQSFDRFLDCAQSGADGGSEGNCLQ 174

  Fly   315 -------EAERHVSAAARQSVEG---------TSTSSYEPPTYSSPGGLRGYPSENYSSSGASGG 363
                   |:...||:..|.:.:|         |::.|:|..:        |..::|.:.||.|  
Zfish   175 KGSSGKPESASQVSSVLRSTADGEKELECEKNTTSGSFETSS--------GTKNDNQTKSGHS-- 229

  Fly   364 LSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTE 428
                    .||.           :||||.||:|||..|||:||.||.|::|:||.:|:|.|.||:
Zfish   230 --------TTPR-----------MRKKRCPYTKFQIRELEREFFFNVYINKEKRLQLSRILNLTD 275

  Fly   429 RQVKIWFQNRRMKNKKNSQRQANQQNNN 456
            |||||||||||||.||.|:.:.:..:.|
Zfish   276 RQVKIWFQNRRMKEKKLSRDRLHYFSGN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 36/52 (69%)
hoxc11bXP_009298848.1 DUF3528 41..180 CDD:288866 29/158 (18%)
Homeobox 237..290 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24582
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.