DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxa13a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001078963.1 Gene:hoxa13a / 570239 ZFINID:ZDB-GENE-990415-5 Length:310 Species:Danio rerio


Alignment Length:301 Identity:86/301 - (28%)
Similarity:128/301 - (42%) Gaps:86/301 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 NAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAG-PGFETDTSAAVK-RHT 254
            |.:.:|.:..:..|  ||::||:.....|            :.|..|| .|.:....:||: ..:
Zfish    39 NFSPSPCRNLMSHP--ASLAPSATYPSSE------------VAAAAAGDSGKQCSPCSAVQGSAS 89

  Fly   255 AHWAYNDEGFNQHYGSGYYDRK---HMFAYPYPET--QFPV-GQYWGPNYRPDQTTSAAAAAAYM 313
            |..:|...|     |.|||..:   |..:....:|  |.|. |..:|..|   ..|||:.     
Zfish    90 ASISYGYFG-----GGGYYPCRMSHHHGSGGGVKTCAQSPASGSPYGEKY---MDTSAST----- 141

  Fly   314 NEAERHVSAAARQSV--EGTSTSSYEP-PTY---------SSPGGLRG---YPSENY-----SSS 358
              .|.:.|:.|::..  ...::|.|:| |:|         |.|...|.   .|.|:|     ::|
Zfish   142 --GEDYTSSRAKEFALYSSYASSPYQPVPSYLDVPVVQAISGPSEPRHESLLPMESYQPWAITTS 204

  Fly   359 GASGGLSVGAVGPCTPNPGLHEWTGQV-------SV-------------RKKRKPYSKFQTLELE 403
            |.:|.:.      ||..   .:.||.|       ||             ||||.||:|.|..|||
Zfish   205 GWNGQVY------CTKE---QQQTGNVWKSSIPESVSHGGADGSSFRRGRKKRVPYTKVQLKELE 260

  Fly   404 KEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444
            :|:..|.:::|.||..::....|:||||.|||||||:|.||
Zfish   261 REYATNKFITKDKRRRISAQTNLSERQVTIWFQNRRVKEKK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 27/52 (52%)
hoxa13aNP_001078963.1 HoxA13_N 29..146 CDD:289085 32/135 (24%)
homeodomain 245..301 CDD:238039 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.