DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxb13a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001038377.1 Gene:hoxb13a / 559921 ZFINID:ZDB-GENE-050812-1 Length:303 Species:Danio rerio


Alignment Length:195 Identity:59/195 - (30%)
Similarity:88/195 - (45%) Gaps:19/195 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 HYGSGYY----DRKHMFAYPYPET-QFPVGQYWG-PNYRPDQTTSAAAAAAYMNEAERHVSAAAR 325
            ::|:.||    .|..:.:...|.. .:...:|.. |....:..|.|...|.|.:....:.|.|:.
Zfish   101 YFGNSYYPCRMGRGSLKSCTQPSALSYTAEKYMDTPVTSEEYPTRAKEFAFYHSYPSPYQSMASY 165

  Fly   326 QSVEGTSTSSYEPPTYSS--------PGGL-RGYPSENYSS--SGASGGLSVGAVGPCTPNPGLH 379
            ..|....|.....|.:.|        |..| .|:.|:.|.|  .|.:|.|...|:.....:.  |
Zfish   166 LDVSVVQTLGTGEPRHDSLLPMDSYQPWALANGWGSQMYCSKDQGQAGHLWKSALADVVAHQ--H 228

  Fly   380 EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444
            :.......||||.||:|.|..|||||:..|.:::|.||.:::....|:|||:.|||||||:|.||
Zfish   229 DGGSFRRGRKKRIPYTKVQLKELEKEYAANKFITKDKRRKISAVTNLSERQITIWFQNRRVKEKK 293

  Fly   445  444
            Zfish   294  293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 27/52 (52%)
hoxb13aNP_001038377.1 HoxA13_N 27..143 CDD:289085 7/41 (17%)
homeodomain 237..293 CDD:238039 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.