DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and pou2f3

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_005172050.1 Gene:pou2f3 / 553427 ZFINID:ZDB-GENE-060512-299 Length:399 Species:Danio rerio


Alignment Length:376 Identity:80/376 - (21%)
Similarity:134/376 - (35%) Gaps:103/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 AVQQ---QHLPAPQQQQQLQQQQQQQQQQLATTPVAGA------------LSPAQTPTG--PS-- 152
            ||:|   ||..|..:|..:...:|.:.:.|..:|.:|:            |.|.|. ||  ||  
Zfish     5 AVEQTESQHEQADIEQNGIDFTRQIKTENLNDSPHSGSSHKTCHLTQGSPLPPGQL-TGEMPSLH 68

  Fly   153 ------AQQQQHLTSPHHQQLPQQQTPNSVASGASSNLQQQQQQQNAAVAPGQTQI-VAPTTASV 210
                  .....||:||....|.|.|:.:...|....||.....|....:.|.|..: :.|.....
Zfish    69 PLPQLVLMPGSHLSSPSSFLLSQAQSGHQGLSLLPPNLLSLPSQTQTGLLPHQPGLALTPQAMGR 133

  Fly   211 SPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDR 275
            |..:.||....::||....|.|:.:.:..|                   ||....:.:...:..|
Zfish   134 SGLAGSSMDGHLDMSHLQVPKHVGSPQDEP-------------------NDLEELEQFAKAFKQR 179

  Fly   276 KHMFAYPYPETQFPVGQYWGPNYRPDQTTSA---AAAAAYMNEA------ERHVSAAARQSVEGT 331
            :....:...:....:|:.:|.::  .|||.:   |...::.|..      |:.:|.|...     
Zfish   180 RIKLGFTQGDVGLAMGKLYGNDF--SQTTISRFEALNLSFKNMCKLKPLLEKWLSDAENS----- 237

  Fly   332 STSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSK 396
                               ||:..:::              |..|.|.|..|     :|||..:.
Zfish   238 -------------------PSDTMTNT--------------TTLPPLMEGYG-----RKRKKRTS 264

  Fly   397 FQT---LELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444
            .:|   |.|||.||.|...:.::...::..|.:.:..|::||.|||.|.|:
Zfish   265 IETNIKLTLEKRFLDNPKPNSEEITLISEQLAMEKEVVRVWFCNRRQKEKR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 19/55 (35%)
pou2f3XP_005172050.1 POU 161..235 CDD:197673 13/94 (14%)
Homeobox 261..314 CDD:278475 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5492
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.