DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxb4

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001094257.1 Gene:Hoxb4 / 497988 RGDID:1560113 Length:250 Species:Rattus norvegicus


Alignment Length:249 Identity:68/249 - (27%)
Similarity:100/249 - (40%) Gaps:73/249 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 EDINMSIQLAPLHIPAIRAG-----PGFETDTS------AAVKRHTAHWAYNDEGFNQHYGSGYY 273
            |:.:.|..|...|.|...||     .||:.:.:      ..|:|:.   |..|.|          
  Rat    21 EEYSQSDYLPSDHSPGYYAGGQRRESGFQPEAAFGRRAPCTVQRYA---ACRDPG---------- 72

  Fly   274 DRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEP 338
                  ..|.|....|...   |...|.....:.|.|......:|.         |..|:|...|
  Rat    73 ------PPPPPPPPPPPPP---PGLSPRAPVQSTAGALLPEPGQRS---------EVVSSSPPPP 119

  Fly   339 PTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSV------------RKKR 391
            |...:|    .:||.::|:              | ..|.::.|..:|.|            ::.|
  Rat   120 PCAQNP----LHPSPSHSA--------------C-KEPVVYPWMRKVHVSTVNPNYAGGEPKRSR 165

  Fly   392 KPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKN 445
            ..|::.|.|||||||.:|.|:::::|.|:|..|.|:|||:||||||||||.||:
  Rat   166 TAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 30/52 (58%)
Hoxb4NP_001094257.1 Homeobox 164..218 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.