DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and repo

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster


Alignment Length:48 Identity:12/48 - (25%)
Similarity:25/48 - (52%) Gaps:15/48 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KIRFDIGP--GRIGRIFAVLDQQDQSRSRVKVIKVLPMVAGEQFLDDP 58
            |.|.::||  |::.:     |.:.:.::.:|:|:      .|:|  ||
  Fly    70 KERIELGPENGKLAK-----DAKIRLKAYIKLIE------REEF--DP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649
repoNP_477026.1 Homeodomain 313..361 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.