DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxc8

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001006787.1 Gene:hoxc8 / 448482 XenbaseID:XB-GENE-480999 Length:242 Species:Xenopus tropicalis


Alignment Length:271 Identity:72/271 - (26%)
Similarity:108/271 - (39%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 PSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDRK 276
            |.|||...         |.::.|:..| |||:         |.:|  :..|.|  |:||......
 Frog    29 PQSVSRSH---------ALVYGPSATA-PGFQ---------HPSH--HVQEFF--HHGSSSLSNS 70

  Fly   277 HMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGT--STSSYEPP 339
                              |....|...|....|:.:..     ..|..|||:.|.  ..|..:.|
 Frog    71 ------------------GFQQNPCALTCHGDASKFYG-----YEALPRQSLYGAQQEASVVQYP 112

  Fly   340 TYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEK 404
            ...|.........:.:.:..:|..|....:.|..|..           |..|:.||::|||||||
 Frog   113 DCKSSSNTNTSEGQGHLNQNSSPSLMFPWMRPHAPGR-----------RSGRQTYSRYQTLELEK 166

  Fly   405 EFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQR---------QANQQNNNNNSS 460
            |||||.|:::::|.|::..|.||||||||||||||||.||.:.:         :..::..|....
 Frog   167 EFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKTEEEGNEEEE 231

  Fly   461 SNHNHAQATQQ 471
            .....::.:::
 Frog   232 KEEEESKESKE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
hoxc8NP_001006787.1 Homeobox 153..206 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.