DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and ro

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster


Alignment Length:180 Identity:57/180 - (31%)
Similarity:82/180 - (45%) Gaps:37/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 DQTTSAAAAAAY-----MNEAERHVSAAARQ---------SVEGTSTSSYEPPTYSSPGGL---- 347
            |:.||.||..||     ..:..:|.|...:|         .:.....|...||...:.||.    
  Fly    94 DERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAANPV 158

  Fly   348 ------RGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEF 406
                  .|:||:.:.|:|.|..|:             .....:...|::|..:|..|||.||.||
  Fly   159 LPHAFPAGFPSDPHFSAGFSAFLA-------------RRRRKEGRQRRQRTTFSTEQTLRLEVEF 210

  Fly   407 LFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNN 456
            ..|.|:|:.:|:|||..|:|||.|:||||||||.|:|:..:.|.:|...|
  Fly   211 HRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 30/52 (58%)
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439752
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.