Sequence 1: | NP_001303472.1 | Gene: | Abd-B / 47763 | FlyBaseID: | FBgn0000015 | Length: | 493 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_476669.3 | Gene: | pb / 40826 | FlyBaseID: | FBgn0051481 | Length: | 782 | Species: | Drosophila melanogaster |
Alignment Length: | 243 | Identity: | 68/243 - (27%) |
---|---|---|---|
Similarity: | 101/243 - (41%) | Gaps: | 75/243 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 300 PDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGL 364
Fly 365 SVG-------------AVGPCTPNPGL-----HEW---------------TGQVSV--------- 387
Fly 388 -RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQAN 451
Fly 452 QQNN-------NNNSSSNHNHAQATQ-------------QHHSGHHLN 479 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Abd-B | NP_001303472.1 | Homeobox | 390..443 | CDD:278475 | 32/52 (62%) |
pb | NP_476669.3 | COG5576 | 168..274 | CDD:227863 | 37/105 (35%) |
Homeobox | 202..254 | CDD:278475 | 32/51 (63%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45439760 | |
Domainoid | 1 | 1.000 | 53 | 1.000 | Domainoid score | I4196 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.930 |