DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and pb

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:243 Identity:68/243 - (27%)
Similarity:101/243 - (41%) Gaps:75/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 PDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGL 364
            |:....:|..|.:|..:|.....:.....|..:..|.|.|...:|.|           |||.||:
  Fly    80 PNCDKRSADTAYWMTASEGGFINSQPSMAEFLNHLSPESPKIGTPVG-----------SGAIGGV 133

  Fly   365 SVG-------------AVGPCTPNPGL-----HEW---------------TGQVSV--------- 387
            .|.             .|.|.||: |:     :.|               .|..|:         
  Fly   134 GVNVNVNVGVGVGYPVGVVPQTPD-GMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGL 197

  Fly   388 -RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQAN 451
             |:.|..|:..|.|||||||.||.|:.:.:|.|:|.:|.|||||||:||||||||:|:.:..:.:
  Fly   198 PRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTD 262

  Fly   452 QQNN-------NNNSSSNHNHAQATQ-------------QHHSGHHLN 479
            .::|       ::.|.||.|..::.|             .:..||:.|
  Fly   263 DEDNKDSLKGDDDQSDSNSNSKKSCQGCELPSDDIPDSTSNSRGHNNN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 32/52 (62%)
pbNP_476669.3 COG5576 168..274 CDD:227863 37/105 (35%)
Homeobox 202..254 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439760
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.