DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and LMX1A

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001167540.1 Gene:LMX1A / 4009 HGNCID:6653 Length:382 Species:Homo sapiens


Alignment Length:118 Identity:33/118 - (27%)
Similarity:53/118 - (44%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 SSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKR--KPYSKFQTLE---LEKEFLFNAYVSKQ 415
            |.:.:..|.|......|....|..:.|.:.....||  :|.:...|.:   .:..|..::...::
Human   159 SPAASDSGKSDDEESLCKSAHGAGKGTAEEGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRK 223

  Fly   416 KRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNN----SSSNHN 464
            .|..||....|:.|.|::||||:|.|.||.::||..||.:..|    ||:..|
Human   224 VRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 17/57 (30%)
LMX1ANP_001167540.1 LIM1_Lmx1a 35..86 CDD:188756
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208 9/46 (20%)
Homeobox 198..252 CDD:395001 15/53 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..285 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.