DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and NANOGP8

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001342210.1 Gene:NANOGP8 / 388112 HGNCID:23106 Length:305 Species:Homo sapiens


Alignment Length:146 Identity:42/146 - (28%)
Similarity:61/146 - (41%) Gaps:23/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 PPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLEL 402
            |.:.:||.|.:...:||          ||.......|          |..:|.|..:|..|...|
Human    66 PDSSTSPKGKQPTSAEN----------SVAKKEDKVP----------VKKQKTRTVFSSTQLCVL 110

  Fly   403 EKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQ 467
            ...|....|:|.|:..||:..|.|:.:|||.||||:|||:|:   .|.|....|:|..:....|.
Human   111 NDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKR---WQKNNWPKNSNGVTQKASAP 172

  Fly   468 ATQQHHSGHHLNLSLN 483
            .....:|.:|....:|
Human   173 TYPSLYSSYHQGCLVN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 23/55 (42%)
NANOGP8NP_001342210.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 10/49 (20%)
Homeodomain 97..152 CDD:459649 23/54 (43%)
8 X repeats starting with a Trp in each unit 196..240
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.