DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxd12

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001178832.1 Gene:Hoxd12 / 366082 RGDID:1309797 Length:268 Species:Rattus norvegicus


Alignment Length:291 Identity:85/291 - (29%)
Similarity:119/291 - (40%) Gaps:61/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GASSNLQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFE 243
            |:..|||.......:.:.|..:|:.|                       |.|:..|. .|.|...
  Rat    13 GSLLNLQSPDSFYFSNLRPNGSQLAA-----------------------LPPISYPR-SALPWAA 53

  Fly   244 TDTSAAVKRHTAHWAYNDEGFNQHY--GSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSA 306
            |..|....:.|...|:.  ||:|.|  |||....:.......||.|...       |.||..|::
  Rat    54 TPASCTPAQPTTASAFG--GFSQPYLTGSGPIGLQSPGTKDGPEDQVKF-------YTPDAATAS 109

  Fly   307 AAAAAYMNEAER------HVSAAARQSVEGTSTSSYEPPTYSSPGG---LRGYPSENYSSSGASG 362
                   .|..|      ..|:....:::||. ..:.....::||.   |:|.|..:.......|
  Rat   110 -------EERSRTRPPFAPESSLVHSALKGTK-YDFAGVGRAAPGSVTLLQGAPCASNFKEDTKG 166

  Fly   363 GLS------VGAVGPCTPN---PGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRW 418
            .|:      |..|..|..:   .||.........|||||||:|.|..|||.|||.|.::::|||.
  Rat   167 PLNLNMAVQVAGVASCLRSSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRK 231

  Fly   419 ELARNLQLTERQVKIWFQNRRMKNKKNSQRQ 449
            ||:..|.|:::||||||||||||.|:..||:
  Rat   232 ELSNRLNLSDQQVKIWFQNRRMKKKRVVQRE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 33/52 (63%)
Hoxd12NP_001178832.1 PRR18 38..>124 CDD:292299 26/125 (21%)
Homeobox 203..256 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.