DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and ap

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster


Alignment Length:172 Identity:36/172 - (20%)
Similarity:56/172 - (32%) Gaps:46/172 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 HVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNP----GLH 379
            |.|.|.    ||.:.||....||...... |.|..:.||..:....|:...|...|..    ||.
  Fly   263 HYSIAR----EGDTASSSMSATYPYSAQF-GSPHNDSSSPHSDPSRSIVPTGIFVPASHVINGLP 322

  Fly   380 EWTGQVSVRKKRKP-------------------------------------YSKFQTLELEKEFL 407
            :...|....:||||                                     :...|...::..|.
  Fly   323 QPARQKGRPRKRKPKDIEAFTANIDLNTEYVDFGRGSHLSSSSRTKRMRTSFKHHQLRTMKSYFA 387

  Fly   408 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQ 449
            .|.....:...:|::...|.:|.:::||||.|.|.::...:|
  Fly   388 INHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQ 429

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 16/92 (17%)
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755