DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXD13

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_000514.2 Gene:HOXD13 / 3239 HGNCID:5136 Length:343 Species:Homo sapiens


Alignment Length:348 Identity:91/348 - (26%)
Similarity:136/348 - (39%) Gaps:80/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 AGALSPAQTPTGPSAQQQQHLTSPHHQQLPQQQTPNSVASGASSNLQQQQQQQNAAVAPGQTQIV 203
            |.:.|.:......|.|.:..|::|             |.:|..|..........||.|...:...
Human    24 ASSSSSSVAAAAASGQCRGFLSAP-------------VFAGTHSGRAAAAAAAAAAAAAAASGFA 75

  Fly   204 APTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHY 268
            .|.|:..:.||.||.    :.::..|....|..:..|. .|..:||....:|...    |:..|:
Human    76 YPGTSERTGSSSSSS----SSAVVAARPEAPPAKECPA-PTPAAAAAAPPSAPAL----GYGYHF 131

  Fly   269 GSGYY----------DRKHMFAYPYPET-QFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSA 322
            |:|||          .:..:.:.|:... .|||.:|.       ..:..|:::...||    |.|
Human   132 GNGYYSCRMSHGVGLQQNALKSSPHASLGGFPVEKYM-------DVSGLASSSVPANE----VPA 185

  Fly   323 AARQSVEGTSTSSYEPPTYSSPGGL-------RGYP-------SENYSSSGASGGLSVGAVGPCT 373
            .|:   |.:....|..|....||.:       .|.|       .|.|.|...:.|.:....  ||
Human   186 RAK---EVSFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVY--CT 245

  Fly   374 PN--PGLHEW----TGQVSV-----------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELA 421
            .:  .|.|.|    .|.|::           ||||.||:|.|..|||.|:..|.:::|.||..::
Human   246 KDQPQGSHFWKSSFPGDVALNQPDMCVYRRGRKKRVPYTKLQLKELENEYAINKFINKDKRRRIS 310

  Fly   422 RNLQLTERQVKIWFQNRRMKNKK 444
            ....|:||||.|||||||:|:||
Human   311 AATNLSERQVTIWFQNRRVKDKK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 27/52 (52%)
HOXD13NP_000514.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 1/3 (33%)
HoxA13_N 39..174 CDD:289085 33/163 (20%)
polyalanine repeat 57..71 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..115 9/41 (22%)
homeodomain 277..333 CDD:238039 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.