DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXD11

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_067015.2 Gene:HOXD11 / 3237 HGNCID:5134 Length:338 Species:Homo sapiens


Alignment Length:355 Identity:101/355 - (28%)
Similarity:128/355 - (36%) Gaps:141/355 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 QNAA--VAPGQTQIVAPTTASVSPSSVSSQKEDINM----SIQLAPLHIPAIRAGPGFETDTSAA 249
            |:||  ..||....|||:..:..||.: ||.....|    |..||| |:..:|         ..|
Human     9 QSAASMYLPGCAYYVAPSDFASKPSFL-SQPSSCQMTFPYSSNLAP-HVQPVR---------EVA 62

  Fly   250 VKRH---TAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGP--------NYRPDQT 303
            .:.:   .|.|.|...|.....|.|                   ....||        .|.|...
Human    63 FRDYGLERAKWPYRGGGGGGSAGGG-------------------SSGGGPGGGGGGAGGYAPYYA 108

  Fly   304 TSAAAAAAYMNEAERHVSAAARQSV---EGTSTSSYEP--------PTYSSPG---GLRGYPSEN 354
            .:||||||         :|||.::.   |....:...|        |..::||   |..|..|..
Human   109 AAAAAAAA---------AAAAEEAAMQRELLPPAGRRPDVLFKAPEPVCAAPGPPHGPAGAASNF 164

  Fly   355 YSSSGASG-------------------------------------------GLSVGAVGPCT-PN 375
            ||:.|.:|                                           |...|...||| ..
Human   165 YSAVGRNGILPQGFDQFYEAAPGPPFAGPQPPPPPAPPQPEGAADKGDPRTGAGGGGGSPCTKAT 229

  Fly   376 PGLH-----EWTG---------------------QVSVRKKRKPYSKFQTLELEKEFLFNAYVSK 414
            ||..     |.:|                     |.| ||||.||:|:|..|||:||.||.|::|
Human   230 PGSEPKGAAEGSGGDGEGPPGEAGAEKSSSAVAPQRS-RKKRCPYTKYQIRELEREFFFNVYINK 293

  Fly   415 QKRWELARNLQLTERQVKIWFQNRRMKNKK 444
            :||.:|:|.|.||:|||||||||||||.||
Human   294 EKRLQLSRMLNLTDRQVKIWFQNRRMKEKK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
HOXD11NP_067015.2 DUF3528 26..185 CDD:288866 43/197 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..270 13/91 (14%)
Homeobox 269..322 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7588
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40637
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.