DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXD10

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_002139.2 Gene:HOXD10 / 3236 HGNCID:5133 Length:340 Species:Homo sapiens


Alignment Length:290 Identity:86/290 - (29%)
Similarity:123/290 - (42%) Gaps:62/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 TASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAA-------------------VKR 252
            |..:.||....:....||.:.:.| :||.:.:.    ||.:.:                   :|.
Human    50 TCGLLPSLAKREVNHQNMGMNVHP-YIPQVDSW----TDPNRSCRIEQPVTQQVPTCSFTTNIKE 109

  Fly   253 HTAHWAYNDEGFNQHYGSGY--YDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNE 315
            .:....|:|:. |:...:..  |.|....:.|....:.||..|    :|..||.:......|.|.
Human   110 ESNCCMYSDKR-NKLISAEVPSYQRLVPESCPVENPEVPVPGY----FRLSQTYATGKTQEYNNS 169

  Fly   316 ----------------AERHVSAAARQSVE--GTSTSSYEPPTYS---SPGGLRGYPSE------ 353
                            |:..:|||..|..:  ....|..||...|   ||....|.|.|      
Human   170 PEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAE 234

  Fly   354 -NYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKR 417
             :.||.......|...:...||.   ..|....|.||||.||:|.||||||||||||.|:::::|
Human   235 VSVSSPEVQEKESKEEIKSDTPT---SNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERR 296

  Fly   418 WELARNLQLTERQVKIWFQNRRMKNKKNSQ 447
            .|:::::.||:|||||||||||||.||.|:
Human   297 LEISKSVNLTDRQVKIWFQNRRMKLKKMSR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
HOXD10NP_002139.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..268 16/70 (23%)
Homeobox 269..323 CDD:395001 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7588
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.