DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXD4

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens


Alignment Length:246 Identity:64/246 - (26%)
Similarity:100/246 - (40%) Gaps:59/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 QYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTY-------SSPGGLRG 349
            :|..|.:.|   ........|:.|..........|..:......|..|.:       |.||....
Human    11 KYVDPKFPP---CEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSA 72

  Fly   350 YPSENYSSS-GASGGLSVGAVGPC--------TPNPG-----------------------LHEWT 382
            .|:..:... |..||.......||        .|.||                       ::.|.
Human    73 LPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWM 137

  Fly   383 GQVSV------------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWF 435
            .:|.|            ::.|..|::.|.|||||||.||.|:::::|.|:|..|.|:|||:||||
Human   138 KKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWF 202

  Fly   436 QNRRMKNKK-----NSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLNLS 481
            ||||||.||     |::.:::..:::::.||:...:|..|.....||.:|:
Human   203 QNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 31/52 (60%)
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 16/95 (17%)
Antp-type hexapeptide 133..138 1/4 (25%)
Homeobox 157..210 CDD:306543 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 8/42 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.