DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXC10

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_059105.2 Gene:HOXC10 / 3226 HGNCID:5122 Length:342 Species:Homo sapiens


Alignment Length:359 Identity:102/359 - (28%)
Similarity:146/359 - (40%) Gaps:84/359 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PQQQTPNSVA------------SGASSNLQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKE 220
            |:..||||.|            |.::....|.....|..|..|         ..::|   |..|.
Human     4 PRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRG---------CGLAP---SLSKR 56

  Fly   221 DINMSIQLAPLHIPAIRAGPGFETDTSAA------VKRHTAHWAYNDEGFNQHYGSGYYDRKH-- 277
            |...|..||....|:..:......|..||      |.|..:..:|......::....|...|.  
Human    57 DEGSSPSLALNTYPSYLSQLDSWGDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKRAK 121

  Fly   278 ------MFAYPYPET-----QFPVGQYW--GPNYRP-DQTTSAAAA---------AAYMNEAERH 319
                  ::::|.||:     :.||..|:  .|:|.. |:|...:.|         .|.:|....|
Human   122 SGPEAALYSHPLPESCLGEHEVPVPSYYRASPSYSALDKTPHCSGANDFEAPFEQRASLNPRAEH 186

  Fly   320 VSA---AARQSVEGTSTSSYEPP------TYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPN 375
            :.:   ..:.|...|..|..:.|      |..|..|.:|.|||:......:...|     |.|.:
Human   187 LESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSS-----PDTSD 246

  Fly   376 PGLHE----------WTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQ 430
            ....|          |....|.||||.||:|.||||||||||||.|:::::|.|:::.:.||:||
Human   247 NEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQ 311

  Fly   431 VKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHN 464
            |||||||||||.||     .|::|.....:||.|
Human   312 VKIWFQNRRMKLKK-----MNRENRIRELTSNFN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
HOXC10NP_059105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..271 18/88 (20%)
Homeobox 271..324 CDD:306543 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7588
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.