DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXC9

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_008828.1 Gene:HOXC9 / 3225 HGNCID:5130 Length:260 Species:Homo sapiens


Alignment Length:279 Identity:90/279 - (32%)
Similarity:120/279 - (43%) Gaps:68/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SSVSSQKEDINMSIQLAPLHIPAIRAGP------GFETDTS----------AAVKRHTAHWA--- 258
            |.:|...||:..|      ..||..|.|      |...|.|          .||  .:..||   
Human    14 SLISHDNEDLLAS------RFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAV--FSTSWAPVP 70

  Fly   259 ------YNDEGFNQHYGSGYYDRKHMFAYPYPET------QFPVGQYWGPNY--RPDQTTSAAAA 309
                  |:..|...|.|:   |.::|..:..|.:      .||.|   |.:|  :||......|.
Human    71 SQSSVVYHPYGPQPHLGA---DTRYMRTWLEPLSGAVSFPSFPAG---GRHYALKPDAYPGRRAD 129

  Fly   310 AAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGA---SGGLSVGAVGP 371
            ..               ..||.|...|   .|.|||.||....:...|..|   :|.........
Human   130 CG---------------PGEGRSYPDY---MYGSPGELRDRAPQTLPSPEADALAGSKHKEEKAD 176

  Fly   372 CTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQ 436
            ..|:..:..|....|.||||.||:|:||||||||||||.|:::.:|:|:||.|.|||||||||||
Human   177 LDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQ 241

  Fly   437 NRRMKNKKNSQRQANQQNN 455
            |||||.||.::.:.:::.:
Human   242 NRRMKMKKMNKEKTDKEQS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 39/52 (75%)
HOXC9NP_008828.1 Hox9_act 1..179 CDD:368024 44/196 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..181 17/78 (22%)
HOX 192..241 CDD:197696 34/48 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7588
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.