DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXB9

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_076922.1 Gene:HOXB9 / 3219 HGNCID:5120 Length:250 Species:Homo sapiens


Alignment Length:233 Identity:75/233 - (32%)
Similarity:96/233 - (41%) Gaps:70/233 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 PETQFPVGQY-----------------------------WGP-----------NYRPDQTTSAAA 308
            |..:||.|||                             |.|           .|.|........
Human    24 PPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVP 88

  Fly   309 AA------AYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYS---SSGASGGL 364
            .|      .::..|.|..:|..    :|.:....| |...:||.|....:..||   |:|....|
Human    89 PAESRYLRTWLEPAPRGEAAPG----QGQAAVKAE-PLLGAPGELLKQGTPEYSLETSAGREAVL 148

  Fly   365 SVGAVG---------------PCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSK 414
            |....|               |...||..: |....|.||||.||:|:||||||||||||.|:::
Human   149 SNQRPGYGDNKICEGSEDKERPDQTNPSAN-WLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTR 212

  Fly   415 QKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQ 452
            .:|.|:||.|.|:||||||||||||||.||.::.|..:
Human   213 DRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 38/52 (73%)
HOXB9NP_076922.1 Hox9_act 1..172 CDD:282473 28/152 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..182 6/33 (18%)
Homeobox 188..241 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7588
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40637
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.