Sequence 1: | NP_001303472.1 | Gene: | Abd-B / 47763 | FlyBaseID: | FBgn0000015 | Length: | 493 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_076922.1 | Gene: | HOXB9 / 3219 | HGNCID: | 5120 | Length: | 250 | Species: | Homo sapiens |
Alignment Length: | 233 | Identity: | 75/233 - (32%) |
---|---|---|---|
Similarity: | 96/233 - (41%) | Gaps: | 70/233 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 284 PETQFPVGQY-----------------------------WGP-----------NYRPDQTTSAAA 308
Fly 309 AA------AYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYS---SSGASGGL 364
Fly 365 SVGAVG---------------PCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSK 414
Fly 415 QKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQ 452 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Abd-B | NP_001303472.1 | Homeobox | 390..443 | CDD:278475 | 38/52 (73%) |
HOXB9 | NP_076922.1 | Hox9_act | 1..172 | CDD:282473 | 28/152 (18%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 21..47 | 6/22 (27%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 149..182 | 6/33 (18%) | |||
Homeobox | 188..241 | CDD:278475 | 38/52 (73%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 92 | 1.000 | Domainoid score | I7588 |
eggNOG | 1 | 0.900 | - | - | E1_KOG0487 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D414477at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 1 | 1.000 | - | - | otm40637 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.910 |